Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.353: AMPKBI-like [160218] (1 superfamily) comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions |
Superfamily d.353.1: AMPKBI-like [160219] (1 family) automatically mapped to Pfam PF04739 |
Family d.353.1.1: AMPKBI-like [160220] (4 proteins) Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region |
Protein automated matches [190789] (2 species) not a true protein |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [188232] (4 PDB entries) |
Domain d2qrdd_: 2qrd D: [151289] Other proteins in same PDB: d2qrda_, d2qrdc_, d2qrde1, d2qrde2, d2qrde3, d2qrdg1, d2qrdg2, d2qrdg3 automated match to d2ooxb1 complexed with adp, atp |
PDB Entry: 2qrd (more details), 2.41 Å
SCOPe Domain Sequences for d2qrdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qrdd_ d.353.1.1 (D:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} eqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhl aaantqlgvlalsattryhrkyvttamfknfd
Timeline for d2qrdd_: