Lineage for d2qrdd_ (2qrd D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011443Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 3011444Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
    automatically mapped to Pfam PF04739
  5. 3011445Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 3011459Protein automated matches [190789] (2 species)
    not a true protein
  7. 3011460Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [188232] (4 PDB entries)
  8. 3011462Domain d2qrdd_: 2qrd D: [151289]
    Other proteins in same PDB: d2qrda_, d2qrdc_, d2qrde1, d2qrde2, d2qrde3, d2qrdg1, d2qrdg2, d2qrdg3
    automated match to d2ooxb1
    complexed with adp, atp

Details for d2qrdd_

PDB Entry: 2qrd (more details), 2.41 Å

PDB Description: Crystal Structure of the Adenylate Sensor from AMP-activated Protein Kinase in complex with ADP and ATP
PDB Compounds: (D:) SPCC1919.03c protein

SCOPe Domain Sequences for d2qrdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qrdd_ d.353.1.1 (D:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
eqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhl
aaantqlgvlalsattryhrkyvttamfknfd

SCOPe Domain Coordinates for d2qrdd_:

Click to download the PDB-style file with coordinates for d2qrdd_.
(The format of our PDB-style files is described here.)

Timeline for d2qrdd_: