Lineage for d2qrdb_ (2qrd B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011443Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 3011444Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
    automatically mapped to Pfam PF04739
  5. 3011445Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 3011459Protein automated matches [190789] (2 species)
    not a true protein
  7. 3011460Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [188232] (4 PDB entries)
  8. 3011461Domain d2qrdb_: 2qrd B: [151287]
    Other proteins in same PDB: d2qrda_, d2qrdc_, d2qrde1, d2qrde2, d2qrde3, d2qrdg1, d2qrdg2, d2qrdg3
    automated match to d2ooxb1
    complexed with adp, atp

Details for d2qrdb_

PDB Entry: 2qrd (more details), 2.41 Å

PDB Description: Crystal Structure of the Adenylate Sensor from AMP-activated Protein Kinase in complex with ADP and ATP
PDB Compounds: (B:) SPCC1919.03c protein

SCOPe Domain Sequences for d2qrdb_:

Sequence, based on SEQRES records: (download)

>d2qrdb_ d.353.1.1 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
seqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnh
laaantqlgvlalsattryhrkyvttamfknfd

Sequence, based on observed residues (ATOM records): (download)

>d2qrdb_ d.353.1.1 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
seqysteipafltsnqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla
aantqlgvlalsattryhrkyvttamfknfd

SCOPe Domain Coordinates for d2qrdb_:

Click to download the PDB-style file with coordinates for d2qrdb_.
(The format of our PDB-style files is described here.)

Timeline for d2qrdb_: