SCOPe 2.02: Domain d2qrdb_: 2qrd B:

Lineage for d2qrdb_ (2qrd B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.353: AMPKBI-like [160218] (1 superfamily)
   comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions

4. Superfamily d.353.1: AMPKBI-like [160219] (1 family)

5. Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
   Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region

6. Protein automated matches [190789] (2 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [188232] (3 PDB entries)

8. Domain d2qrdb_: 2qrd B: [151287]
   Other proteins in same PDB: d2qrda_, d2qrdc_
   automated match to d2ooxb1
   complexed with adp, atp

Details for d2qrdb_

PDB Entry: 2qrd, 2.41 Å

PDB Description: Crystal Structure of the Adenylate Sensor from AMP-activated Protein Kinase in complex with ADP and ATP

PDB Compounds: (B:) SPCC1919.03c protein

SCOPe Domain Sequences for d2qrdb_:

Sequence, based on SEQRES records:

>d2qrdb_ d.353.1.1 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
seqysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnh
laaantqlgvlalsattryhrkyvttamfknfd

Sequence, based on observed residues (ATOM records):

>d2qrdb_ d.353.1.1 (B:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
seqysteipafltsnqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla
aantqlgvlalsattryhrkyvttamfknfd

Timeline for d2qrdb_:

• d2qrdb_ first appeared in SCOP 1.75, called d2qrdb1
  
• d2qrdb_ appears in SCOPe 2.01
  
• d2qrdb_ appears in SCOPe 2.03
  
• d2qrdb_ appears in the current release, SCOPe 2.08