![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins) automatically mapped to Pfam PF00754 |
![]() | Protein C2 domain of factor VIII [49794] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49795] (5 PDB entries) |
![]() | Domain d2qqna_: 2qqn A: [151223] Other proteins in same PDB: d2qqnh_, d2qqnl1, d2qqnl2 automated match to d1kexa_ complexed with edo |
PDB Entry: 2qqn (more details), 2.2 Å
SCOPe Domain Sequences for d2qqna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qqna_ b.18.1.2 (A:) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} kcmealgmesgeihsdqitassqystnwsaersrlnypengwtpgedsyrewiqvdlgll rfvtavgtqgaisketkkkyyvktykidvssngedwitikegnkpvlfqgntnptdvvva vfpkplitrfvrikpatwetgismrfevygckit
Timeline for d2qqna_: