Lineage for d2qqnh_ (2qqn H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742934Domain d2qqnh_: 2qqn H: [408178]
    Other proteins in same PDB: d2qqna_, d2qqnl1, d2qqnl2
    automated match to d6shgh_
    complexed with edo

Details for d2qqnh_

PDB Entry: 2qqn (more details), 2.2 Å

PDB Description: neuropilin-1 b1 domain in complex with a vegf-blocking fab
PDB Compounds: (H:) antibody heavy chain

SCOPe Domain Sequences for d2qqnh_:

Sequence, based on SEQRES records: (download)

>d2qqnh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsqispaggytny
adsvkgrftisadtskntaylqmnslraedtavyycargelpyyrmskvmdvwgqgtlvt
vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth

Sequence, based on observed residues (ATOM records): (download)

>d2qqnh_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsqispaggytny
adsvkgrftisadtskntaylqmnslraedtavyycargelpyyrmskvmdvwgqgtlvt
vssastkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth

SCOPe Domain Coordinates for d2qqnh_:

Click to download the PDB-style file with coordinates for d2qqnh_.
(The format of our PDB-style files is described here.)

Timeline for d2qqnh_:

  • d2qqnh_ is new in SCOPe 2.08-stable