SCOPe 2.08: Domain d2qp0r1: 2qp0 R:19-73

Lineage for d2qp0r1 (2qp0 R:19-73)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
   Uniprot P0A7T7 19-73

8. Domain d2qp0r1: 2qp0 R:19-73 [151160]
   Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0s1, d2qp0t1, d2qp0u1
   protein/RNA complex; complexed with mg, nmy, scm
   protein/RNA complex; complexed with mg, nmy, scm

Details for d2qp0r1

PDB Entry: 2qp0, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2qp0r1:

Sequence; same for both SEQRES and ATOM records:

>d2qp0r1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

Timeline for d2qp0r1:

• d2qp0r1 first appeared in SCOP 1.75
  
• d2qp0r1 appears in SCOPe 2.07