SCOPe 2.06: Domain d2qohb2: 2qoh B:229-511

Lineage for d2qohb2 (2qoh B:229-511)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187169] (38 PDB entries)

8. Domain d2qohb2: 2qoh B:229-511 [150983]
   Other proteins in same PDB: d2qoha3, d2qohb3
   automated match to d1opjb_
   complexed with p3y

Details for d2qohb2

PDB Entry: 2qoh, 1.95 Å

PDB Description: Crystal Structure of Abl kinase bound with PPY-A

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d2qohb2:

Sequence, based on SEQRES records:

>d2qohb2 d.144.1.7 (B:229-511) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfqessisdevekelg

Sequence, based on observed residues (ATOM records):

>d2qohb2 d.144.1.7 (B:229-511) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkmeveeflkeaavmk
eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam
eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl
aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel
mracwqwnpsdrpsfaeihqafetmfqessisdevekelg

Timeline for d2qohb2:

• d2qohb2 first appeared in SCOP 1.75, called d2qohb1
  
• d2qohb2 was called d2qohb_ in SCOPe 2.05
  
• d2qohb2 appears in SCOPe 2.07
  
• d2qohb2 appears in the current release, SCOPe 2.08