Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Abelsone tyrosine kinase (abl) [56166] (1 species) PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase |
Species Mouse (Mus musculus) [TaxId:10090] [56167] (9 PDB entries) |
Domain d2qohb1: 2qoh B:229-501 [150983] automatically matched to d1opjb_ complexed with p3y |
PDB Entry: 2qoh (more details), 1.95 Å
SCOP Domain Sequences for d2qohb1:
Sequence, based on SEQRES records: (download)
>d2qohb1 d.144.1.7 (B:229-501) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv yelmracwqwnpsdrpsfaeihqafetmfqess
>d2qohb1 d.144.1.7 (B:229-501) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkmeveeflkeaavmk eikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissam eylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesl aynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyel mracwqwnpsdrpsfaeihqafetmfqess
Timeline for d2qohb1: