SCOPe 2.02: Domain d2qnho1: 2qnh o:2-61

Lineage for d2qnho1 (2qnh o:2-61)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
   Uniprot P24320

8. Domain d2qnho1: 2qnh o:2-61 [150938]
   Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhf1, d2qnhg1, d2qnhh1, d2qnhi1, d2qnhj1, d2qnhk1, d2qnhl1, d2qnhm1, d2qnhn1, d2qnhp1, d2qnhq1, d2qnhr1, d2qnhs1, d2qnht1, d2qnhu1, d2qnhv1
   automatically matched to d1fjgn_

Details for d2qnho1

PDB Entry: 2qnh, 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 2QNH, contains the 30S ribosome subunit, two TRNA, and MRNA molecules. 50S ribosome subunit is in the file 1VSP.

PDB Compounds: (o:) 30s ribosomal protein s14 type z

SCOPe Domain Sequences for d2qnho1:

Sequence; same for both SEQRES and ATOM records:

>d2qnho1 g.39.1.7 (o:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d2qnho1:

• d2qnho1 first appeared in SCOP 1.75
  
• d2qnho1 appears in SCOPe 2.01
  
• d2qnho1 appears in SCOPe 2.03
  
• d2qnho1 appears in the current release, SCOPe 2.08