Lineage for d2qnhi1 (2qnh i:1-138)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219328Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 1219329Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
  5. 1219330Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 1219331Protein Ribosomal protein S8 [56049] (4 species)
  7. 1219349Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 1219391Domain d2qnhi1: 2qnh i:1-138 [150932]
    Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhf1, d2qnhg1, d2qnhh1, d2qnhj1, d2qnhk1, d2qnhl1, d2qnhm1, d2qnhn1, d2qnho1, d2qnhp1, d2qnhq1, d2qnhr1, d2qnhs1, d2qnht1, d2qnhu1, d2qnhv1
    automatically matched to d1fjgh_

Details for d2qnhi1

PDB Entry: 2qnh (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 2QNH, contains the 30S ribosome subunit, two TRNA, and MRNA molecules. 50S ribosome subunit is in the file 1VSP.
PDB Compounds: (i:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2qnhi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qnhi1 d.140.1.1 (i:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d2qnhi1:

Click to download the PDB-style file with coordinates for d2qnhi1.
(The format of our PDB-style files is described here.)

Timeline for d2qnhi1: