Lineage for d2qmga_ (2qmg A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408655Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2408656Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2410318Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2410376Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2410377Species Human (Homo sapiens) [TaxId:9606] [50672] (329 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2410628Domain d2qmga_: 2qmg A: [150882]
    automated match to d1fkna_
    complexed with sc6, tar

Details for d2qmga_

PDB Entry: 2qmg (more details), 1.89 Å

PDB Description: structure of bace bound to sch745966
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d2qmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmga_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyni

SCOPe Domain Coordinates for d2qmga_:

Click to download the PDB-style file with coordinates for d2qmga_.
(The format of our PDB-style files is described here.)

Timeline for d2qmga_: