Lineage for d2qm8a_ (2qm8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2111984Protein Metallochaperone MeaB [159564] (1 species)
    ArgK-like (sub)family; Pfam PF03308
  7. 2111985Species Methylobacterium extorquens [TaxId:408] [159565] (5 PDB entries)
    Uniprot Q8RPA0 5-327
  8. 2111986Domain d2qm8a_: 2qm8 A: [150874]
    automated match to d2qm7a1
    complexed with po4

Details for d2qm8a_

PDB Entry: 2qm8 (more details), 1.7 Å

PDB Description: MeaB, A Bacterial Homolog of MMAA, in the Nucleotide Free Form
PDB Compounds: (A:) GTPase/ATPase

SCOPe Domain Sequences for d2qm8a_:

Sequence, based on SEQRES records: (download)

>d2qm8a_ c.37.1.10 (A:) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}
tlpdmdtlrerllagdraalaraitlaesrradhraavrdlidavlpqtgrairvgitgv
pgvgksttidalgslltaaghkvavlavdpsstrtggsilgdktrmarlaidrnafirps
pssgtlggvaaktretmllceaagfdvilvetvgvgqsetavadltdfflvlmlpgagde
lqgikkgifeladmiavnkaddgdgerrasaaaseyraalhiltppsatwtppvvtisgl
hgkgldslwsriedhrskltatgeiagkrreqdvkwmwalvherlhqrlvgsaevrqata
eaeravaggehspaagadaiatligl

Sequence, based on observed residues (ATOM records): (download)

>d2qm8a_ c.37.1.10 (A:) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}
tlpdmdtlrerllagdraalaraitlaesrradhraavrdlidavlpqtgrairvgitgv
pgvgksttidalgslltaaghkvavlavdpsstrtggsilgdktrmarlaidrnafirps
pssgtlggvaaktretmllceaagfdvilvetvgvgqsetavadltdfflvlmlpgaikk
gifeladmiavnkaddgdgerrasaaaseyraalhiltppsatwtppvvtisglhgkgld
slwsriedhrskltatgeiagkrreqdvkwmwalvherlhqrlvgsaevrqataeaerav
aggehspaagadaiatligl

SCOPe Domain Coordinates for d2qm8a_:

Click to download the PDB-style file with coordinates for d2qm8a_.
(The format of our PDB-style files is described here.)

Timeline for d2qm8a_: