Lineage for d2qkaa1 (2qka A:1-83)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690050Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2690322Protein automated matches [227044] (4 species)
    not a true protein
  7. 2690331Species Human (Homo sapiens) [TaxId:9606] [255568] (2 PDB entries)
  8. 2690334Domain d2qkaa1: 2qka A:1-83 [150839]
    Other proteins in same PDB: d2qkaa2, d2qkac2
    automated match to d1pl4a1
    complexed with mn

Details for d2qkaa1

PDB Entry: 2qka (more details), 2.2 Å

PDB Description: structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2qkaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkaa1 a.2.11.1 (A:1-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkanggghinhsifwtnlsp

SCOPe Domain Coordinates for d2qkaa1:

Click to download the PDB-style file with coordinates for d2qkaa1.
(The format of our PDB-style files is described here.)

Timeline for d2qkaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qkaa2