![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein automated matches [226880] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255569] (2 PDB entries) |
![]() | Domain d2qkac2: 2qka C:84-196 [150842] Other proteins in same PDB: d2qkaa1, d2qkac1 automated match to d1xila2 complexed with mn |
PDB Entry: 2qka (more details), 2.2 Å
SCOPe Domain Sequences for d2qkac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qkac2 d.44.1.1 (C:84-196) automated matches {Human (Homo sapiens) [TaxId: 9606]} ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymac
Timeline for d2qkac2: