SCOPe 2.06: Domain d2qivx_: 2qiv X:

Lineage for d2qivx_ (2qiv X:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (1 protein)
   this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain

6. Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species)

7. Species Escherichia coli, gene lpxA [TaxId:562] [51164] (6 PDB entries)

8. Domain d2qivx_: 2qiv X: [150814]
   automated match to d1lxaa_
   complexed with u21

Details for d2qivx_

PDB Entry: 2qiv, 1.85 Å

PDB Description: structural basis for the acyl chain selectivity and mechanism of udp- n-acetylglucosamine acyltransferase

PDB Compounds: (X:) UDP-N-acetylglucosamine acyltransferase

SCOPe Domain Sequences for d2qivx_:

Sequence; same for both SEQRES and ATOM records:

>d2qivx_ b.81.1.1 (X:) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]}
midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn
eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin
ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd
vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela
etypevkaftdffarstrglir

Timeline for d2qivx_:

• d2qivx_ first appeared in SCOP 1.75, called d2qivx1
  
• d2qivx_ appears in SCOPe 2.05
  
• d2qivx_ appears in SCOPe 2.07
  
• d2qivx_ appears in the current release, SCOPe 2.08