Lineage for d2qivx_ (2qiv X:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069507Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (1 protein)
  6. 2069508Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species)
  7. 2069509Species Escherichia coli, gene lpxA [TaxId:562] [51164] (6 PDB entries)
  8. 2069512Domain d2qivx_: 2qiv X: [150814]
    automated match to d1lxaa_
    complexed with u21

Details for d2qivx_

PDB Entry: 2qiv (more details), 1.85 Å

PDB Description: structural basis for the acyl chain selectivity and mechanism of udp- n-acetylglucosamine acyltransferase
PDB Compounds: (X:) UDP-N-acetylglucosamine acyltransferase

SCOPe Domain Sequences for d2qivx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qivx_ b.81.1.1 (X:) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]}
midksafvhptaiveegasiganahigpfcivgphveigegtvlkshvvvnghtkigrdn
eiyqfasigevnqdlkyageptrveigdrnriresvtihrgtvqgggltkvgsdnllmin
ahiahdctvgnrcilannatlaghvsvddfaiiggmtavhqfciigahvmvggcsgvaqd
vppyviaqgnhatpfgvnieglkrrgfsreaitairnaykliyrsgktldevkpeiaela
etypevkaftdffarstrglir

SCOPe Domain Coordinates for d2qivx_:

Click to download the PDB-style file with coordinates for d2qivx_.
(The format of our PDB-style files is described here.)

Timeline for d2qivx_: