SCOPe 2.07: Domain d2qhba_: 2qhb A:

Lineage for d2qhba_ (2qhb A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein Telomere binding protein TBP1 [158244] (1 species)

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [158245] (2 PDB entries)
   Uniprot Q84ZU4 578-660

8. Domain d2qhba_: 2qhb A: [150786]
   automated match to d2ckxa1
   protein/DNA complex

Details for d2qhba_

PDB Entry: 2qhb, 2.4 Å

PDB Description: crystal structure of ngtrf complexed with telomeric dna

PDB Compounds: (A:) telomere binding protein tbp1

SCOPe Domain Sequences for d2qhba_:

Sequence; same for both SEQRES and ATOM records:

>d2qhba_ a.4.1.3 (A:) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
rrirrpfsvaevealveavehlgtgrwrdvkmrafdnadhrtyvdlkdkwktlvhtasia
pqqrrgepvpqdlldrvlaahaywsq

Timeline for d2qhba_:

• d2qhba_ first appeared in SCOP 1.75, called d2qhba1
  
• d2qhba_ appears in SCOPe 2.06
  
• d2qhba_ appears in the current release, SCOPe 2.08