Lineage for d2qhba_ (2qhb A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981823Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 1981906Protein Telomere binding protein TBP1 [158244] (1 species)
  7. 1981907Species Tobacco (Nicotiana tabacum) [TaxId:4097] [158245] (2 PDB entries)
    Uniprot Q84ZU4 578-660
  8. 1981909Domain d2qhba_: 2qhb A: [150786]
    automated match to d2ckxa1
    protein/DNA complex

Details for d2qhba_

PDB Entry: 2qhb (more details), 2.4 Å

PDB Description: crystal structure of ngtrf complexed with telomeric dna
PDB Compounds: (A:) telomere binding protein tbp1

SCOPe Domain Sequences for d2qhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qhba_ a.4.1.3 (A:) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
rrirrpfsvaevealveavehlgtgrwrdvkmrafdnadhrtyvdlkdkwktlvhtasia
pqqrrgepvpqdlldrvlaahaywsq

SCOPe Domain Coordinates for d2qhba_:

Click to download the PDB-style file with coordinates for d2qhba_.
(The format of our PDB-style files is described here.)

Timeline for d2qhba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qhbb_