| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
| Family d.159.1.1: Purple acid phosphatase-like [56301] (3 proteins) |
| Protein Plant purple acid phosphatase, catalytic domain [56302] (2 species) also contain an Ig-like domain |
| Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [56303] (5 PDB entries) |
| Domain d2qfrb2: 2qfr B:121-432 [150753] Other proteins in same PDB: d2qfra1, d2qfrb1 automatically matched to d1kbpa2 complexed with fe, nag, ndg, so4, zn |
PDB Entry: 2qfr (more details), 2.4 Å
SCOPe Domain Sequences for d2qfrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qfrb2 d.159.1.1 (B:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}
qtgldvpytfgligdlgqsfdsnttlshyelspkkgqtvlfvgdlsyadrypnhdnvrwd
twgrftersvayqpwiwtagnheiefapeinetepfkpfsyryhvpyeasqstspfwysi
krasahiivlssysaygrgtpqytwlkkelrkvkrsetpwlivlmhsplynsynhhfmeg
eamrtkfeawfvkykvdvvfaghvhayerservsniaykitnglctpvkdqsapvyitig
dagnygvidsnmiqpqpeysafreasfghgmfdiknrthahfswnrnqdgvaveadsvwf
fnrhwypvddst
Timeline for d2qfrb2: