SCOPe 2.04: Domain d2qf0h_: 2qf0 H:

Lineage for d2qf0h_ (2qf0 H:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Stress sensor protease DegS, catalytic domain [110236] (1 species)

7. Species Escherichia coli [TaxId:562] [110237] (11 PDB entries)
   Uniprot P31137 37-354 ! Uniprot P31137

8. Domain d2qf0h_: 2qf0 H: [150722]
   automated match to d3lgib_

Details for d2qf0h_

PDB Entry: 2qf0, 2.5 Å

PDB Description: structure of the delta pdz truncation of the degs protease

PDB Compounds: (H:) Protease degS

SCOPe Domain Sequences for d2qf0h_:

Sequence, based on SEQRES records:

>d2qf0h_ b.47.1.1 (H:) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
etpasynlavrraapavvnvynrglntnshnqleirtlgsgvimdqrgyiitnkhvinda
dqiivalqdgrvfeallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignp
ynlgqtitqgiisatgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfd
ksndgetpegigfaipfqlatkimdklirdg

Sequence, based on observed residues (ATOM records):

>d2qf0h_ b.47.1.1 (H:) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}
etpasynlavrraapavvnvynirtlgsgvimdqrgyiitnkhvindadqiivalqdgrv
feallvgsdsltdlavlkinatgglptipinarrvphigdvvlaignpynlgqtitqgii
satgriglnptgrqnflqtdasinhgnsggalvnslgelmgintlsfdkgetpegigfai
pfqlatkimdklirdg

Timeline for d2qf0h_:

• d2qf0h_ first appeared in SCOP 1.75, called d2qf0h1
  
• d2qf0h_ was called d2qf0h1 in SCOPe 2.03
  
• d2qf0h_ appears in SCOPe 2.05
  
• d2qf0h_ appears in the current release, SCOPe 2.08