Lineage for d1f63a_ (1f63 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978189Protein Myoglobin [46469] (10 species)
  7. 1978334Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (267 PDB entries)
    Uniprot P02185
  8. 1978462Domain d1f63a_: 1f63 A: [15072]
    complexed with hem, so4; mutant

Details for d1f63a_

PDB Entry: 1f63 (more details), 1.8 Å

PDB Description: crystal structure of deoxy sperm whale myoglobin mutant y(b10)q(e7) r(e10)
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1f63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f63a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1f63a_:

Click to download the PDB-style file with coordinates for d1f63a_.
(The format of our PDB-style files is described here.)

Timeline for d1f63a_: