PDB entry 1f63

View 1f63 on RCSB PDB site
Description: crystal structure of deoxy sperm whale myoglobin mutant y(b10)q(e7)r(e10)
Class: oxygen storage/transport
Keywords: myoglobin, heme, triple mutant, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2000-06-20, released 2000-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • initiating methionine (0)
      • engineered (29)
      • engineered (64)
      • engineered (67)
    Domains in SCOPe 2.06: d1f63a_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f63A (A:)
    mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
    dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg