SCOPe 2.07: Domain d2qexk1: 2qex K:1-132

Lineage for d2qexk1 (2qex K:1-132)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)
   automatically mapped to Pfam PF00238

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
   Uniprot P22450

8. Domain d2qexk1: 2qex K:1-132 [150699]
   Other proteins in same PDB: d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1
   automatically matched to d1s72k_
   complexed with cd, cl, k, mg, na, neg

Details for d2qexk1

PDB Entry: 2qex, 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit

PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d2qexk1:

Sequence; same for both SEQRES and ATOM records:

>d2qexk1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

Timeline for d2qexk1:

• d2qexk1 first appeared in SCOP 1.75
  
• d2qexk1 appears in SCOPe 2.06
  
• d2qexk1 appears in the current release, SCOPe 2.08