Class b: All beta proteins [48724] (178 folds) |
Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) automatically mapped to Pfam PF00238 |
Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
Protein Ribosomal protein L14 [50195] (5 species) |
Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries) Uniprot P22450 |
Domain d1s72k_: 1s72 K: [105330] Other proteins in same PDB: d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ complexed with cd, cl, k, mg, na |
PDB Entry: 1s72 (more details), 2.4 Å
SCOPe Domain Sequences for d1s72k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s72k_ b.39.1.1 (K:) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]} mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr fgsvasaatmiv
Timeline for d1s72k_:
View in 3D Domains from other chains: (mouse over for more information) d1s721_, d1s722_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_ |