| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (3 families) ![]() |
| Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
| Protein Ribosomal protein L7ae [55319] (7 species) |
| Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries) Uniprot P12743 |
| Domain d2qexf1: 2qex F:1-119 [150694] Other proteins in same PDB: d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1 automatically matched to d1s72f_ complexed with cd, cl, k, mg, na, neg |
PDB Entry: 2qex (more details), 2.9 Å
SCOPe Domain Sequences for d2qexf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qexf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr
Timeline for d2qexf1:
View in 3DDomains from other chains: (mouse over for more information) d2qex11, d2qex21, d2qex31, d2qexb1, d2qexc1, d2qexd1, d2qexg1, d2qexh1, d2qexi1, d2qexj1, d2qexk1, d2qexl1, d2qexm1, d2qexn1, d2qexo1, d2qexp1, d2qexq1, d2qexr1, d2qexs1, d2qext1, d2qexu1, d2qexv1, d2qexw1, d2qexx1, d2qexy1, d2qexz1 |