Lineage for d2qexv1 (2qex V:1-65)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1249271Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1249272Protein 50S subunit [58125] (6 species)
  7. 1249421Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1249644Domain d2qexv1: 2qex V:1-65 [150710]
    Other proteins in same PDB: d2qex21, d2qexb1, d2qexc1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexk1, d2qexm1, d2qexp1, d2qexr1, d2qexs1, d2qexy1, d2qexz1
    automatically matched to d1w2bu_
    complexed with cd, cl, k, mg, na, neg

Details for d2qexv1

PDB Entry: 2qex (more details), 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d2qexv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qexv1 i.1.1.2 (V:1-65) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d2qexv1:

Click to download the PDB-style file with coordinates for d2qexv1.
(The format of our PDB-style files is described here.)

Timeline for d2qexv1: