Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) |
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
Protein Ribosomal protein S18 [46913] (2 species) |
Species Escherichia coli [TaxId:562] [158351] (24 PDB entries) Uniprot P0A7T7 19-73 |
Domain d2qbjr1: 2qbj R:19-73 [150612] Other proteins in same PDB: d2qbjb1, d2qbjc1, d2qbjc2, d2qbjd1, d2qbje1, d2qbje2, d2qbjf1, d2qbjg1, d2qbjh1, d2qbji1, d2qbjj1, d2qbjk1, d2qbjl1, d2qbjm1, d2qbjn1, d2qbjp1, d2qbjq1, d2qbjs1, d2qbjt1, d2qbju1 protein/RNA complex; complexed with lll, mg protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qbj (more details), 4 Å
SCOPe Domain Sequences for d2qbjr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbjr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]} eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh
Timeline for d2qbjr1: