SCOPe 2.08: Domain d2qbgc1: 2qbg C:125-269

Lineage for d2qbgc1 (2qbg C:125-269)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Escherichia coli [TaxId:562] [159027] (27 PDB entries)
   Uniprot P60422 125-269

8. Domain d2qbgc1: 2qbg C:125-269 [150513]
   Other proteins in same PDB: d2qbg01, d2qbg11, d2qbg31, d2qbg41, d2qbg61, d2qbgc2, d2qbgd1, d2qbge1, d2qbgf1, d2qbgg1, d2qbgg2, d2qbgh1, d2qbgh2, d2qbgi1, d2qbgi2, d2qbgj1, d2qbgk1, d2qbgl1, d2qbgm1, d2qbgn1, d2qbgo1, d2qbgp1, d2qbgq1, d2qbgr1, d2qbgs1, d2qbgt1, d2qbgu1, d2qbgv1, d2qbgw1, d2qbgx1, d2qbgy1, d2qbgz1
   protein/RNA complex; complexed with mg, zn
   protein/RNA complex; complexed with mg, zn

Details for d2qbgc1

PDB Entry: 2qbg, 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 50S subunit of the second 70S ribosome, with RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2qbgc1:

Sequence; same for both SEQRES and ATOM records:

>d2qbgc1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve
adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv
tpwgvqtkgkktrsnkrtdkfivrr

Timeline for d2qbgc1:

• d2qbgc1 first appeared in SCOP 1.75
  
• d2qbgc1 appears in SCOPe 2.07