Lineage for d2qbgi1 (2qbg I:73-141)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695423Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2695424Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2695425Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2695443Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
    Uniprot P0A7J7 73-141
  8. 2695447Domain d2qbgi1: 2qbg I:73-141 [150522]
    Other proteins in same PDB: d2qbg01, d2qbg11, d2qbg31, d2qbg41, d2qbg61, d2qbgc1, d2qbgc2, d2qbgd1, d2qbge1, d2qbgf1, d2qbgg1, d2qbgg2, d2qbgh1, d2qbgh2, d2qbgi2, d2qbgj1, d2qbgk1, d2qbgl1, d2qbgm1, d2qbgn1, d2qbgo1, d2qbgp1, d2qbgq1, d2qbgr1, d2qbgs1, d2qbgt1, d2qbgu1, d2qbgv1, d2qbgw1, d2qbgx1, d2qbgy1, d2qbgz1
    protein/RNA complex; complexed with mg, zn
    protein/RNA complex; complexed with mg, zn

Details for d2qbgi1

PDB Entry: 2qbg (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 50S subunit of the second 70S ribosome, with RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2qbgi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbgi1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

SCOPe Domain Coordinates for d2qbgi1:

Click to download the PDB-style file with coordinates for d2qbgi1.
(The format of our PDB-style files is described here.)

Timeline for d2qbgi1: