Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S17 [50304] (3 species) |
Species Escherichia coli [TaxId:562] [159088] (26 PDB entries) Uniprot P02373 3-82 |
Domain d2qbfq1: 2qbf Q:3-82 [150503] Other proteins in same PDB: d2qbfb1, d2qbfc1, d2qbfc2, d2qbfd1, d2qbfe1, d2qbfe2, d2qbff1, d2qbfg1, d2qbfh1, d2qbfi1, d2qbfj1, d2qbfk1, d2qbfl1, d2qbfm1, d2qbfn1, d2qbfp1, d2qbfr1, d2qbfs1, d2qbft1, d2qbfu1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2qbf (more details), 3.3 Å
SCOPe Domain Sequences for d2qbfq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbfq1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]} kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire crplsktkswtlvrvvekav
Timeline for d2qbfq1: