Lineage for d2qbfj1 (2qbf J:5-102)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953733Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
    automatically mapped to Pfam PF00338
  5. 2953734Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 2953735Protein Ribosomal protein S10 [55001] (2 species)
  7. 2953736Species Escherichia coli [TaxId:562] [160319] (24 PDB entries)
    Uniprot P0A7R5 5-102
  8. 2953740Domain d2qbfj1: 2qbf J:5-102 [150497]
    Other proteins in same PDB: d2qbfb1, d2qbfc1, d2qbfc2, d2qbfd1, d2qbfe1, d2qbfe2, d2qbff1, d2qbfg1, d2qbfh1, d2qbfi1, d2qbfk1, d2qbfl1, d2qbfm1, d2qbfn1, d2qbfp1, d2qbfq1, d2qbfr1, d2qbfs1, d2qbft1, d2qbfu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2qbfj1

PDB Entry: 2qbf (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2qbfj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbfj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]}
ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
yeirthlrlvdiveptektvdalmrldlaagvdvqisl

SCOPe Domain Coordinates for d2qbfj1:

Click to download the PDB-style file with coordinates for d2qbfj1.
(The format of our PDB-style files is described here.)

Timeline for d2qbfj1: