Lineage for d2qb0a_ (2qb0 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493398Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1493399Family a.60.1.1: Pointed domain [47770] (7 proteins)
  6. 1493409Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)
  7. 1493410Species Escherichia coli [TaxId:562] [158525] (3 PDB entries)
  8. 1493415Domain d2qb0a_: 2qb0 A: [150324]
    automated match to d1ji7a_
    complexed with mn

Details for d2qb0a_

PDB Entry: 2qb0 (more details), 2.56 Å

PDB Description: structure of the 2tel crystallization module fused to t4 lysozyme with an ala-gly-pro linker.
PDB Compounds: (A:) E80-TELSAM domain

SCOPe Domain Sequences for d2qb0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qb0a_ a.60.1.1 (A:) Etv6 transcription factor pointed domain (Tel SAM) {Escherichia coli [TaxId: 562]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
phsgdelyellqhilkq

SCOPe Domain Coordinates for d2qb0a_:

Click to download the PDB-style file with coordinates for d2qb0a_.
(The format of our PDB-style files is described here.)

Timeline for d2qb0a_: