| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.1: Pointed domain [47770] (6 proteins) |
| Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species) |
| Species Escherichia coli [TaxId:562] [158525] (3 PDB entries) |
| Domain d2qb0a_: 2qb0 A: [150324] automated match to d1ji7a_ complexed with mn |
PDB Entry: 2qb0 (more details), 2.56 Å
SCOPe Domain Sequences for d2qb0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qb0a_ a.60.1.1 (A:) Etv6 transcription factor pointed domain (Tel SAM) {Escherichia coli [TaxId: 562]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
phsgdelyellqhilkq
Timeline for d2qb0a_: