SCOP 1.63: Domain d1bvd__: 1bvd -

Lineage for d1bvd__ (1bvd -)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (137 PDB entries)

8. Domain d1bvd__: 1bvd - [15027]
   apo form complexed with biliverdin IX
   complexed with bla

Details for d1bvd__

PDB Entry: 1bvd, 1.4 Å

PDB Description: structure of a biliverdin apomyoglobin complex (form b) at 98 k

SCOP Domain Sequences for d1bvd__:

Sequence; same for both SEQRES and ATOM records:

>d1bvd__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1bvd__:

• d1bvd__ first appeared (with stable ids) in SCOP 1.55
  
• d1bvd__ appears in SCOP 1.61
  
• d1bvd__ appears in SCOP 1.65
  
• d1bvd__ appears in the current release, SCOPe 2.08, called d1bvda_