![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Myoglobin [46469] (11 species) |
![]() | Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries) Uniprot P02185 |
![]() | Domain d1bvda_: 1bvd A: [15027] apo form complexed with biliverdin IX complexed with bla |
PDB Entry: 1bvd (more details), 1.4 Å
SCOPe Domain Sequences for d1bvda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvda_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]} vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp gdfgadaqgamnkalelfrkdiaakykelgyqg
Timeline for d1bvda_: