![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.3: Decarboxylase [51375] (4 proteins) |
![]() | Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species) |
![]() | Species Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId:36329] [159376] (5 PDB entries) |
![]() | Domain d2qafb2: 2qaf B:1-321 [150212] Other proteins in same PDB: d2qafa3, d2qafb3 automated match to d2f84a1 complexed with so4, u5p |
PDB Entry: 2qaf (more details), 1.95 Å
SCOPe Domain Sequences for d2qafb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qafb2 c.1.2.3 (B:1-321) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]} mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp ypqkaaqmyydqinailkqnm
Timeline for d2qafb2: