Lineage for d2qafa2 (2qaf A:1-322)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2413882Family c.1.2.3: Decarboxylase [51375] (4 protein domains)
  6. 2414001Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)
  7. 2414009Species Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId:36329] [159376] (5 PDB entries)
  8. 2414014Domain d2qafa2: 2qaf A:1-322 [150211]
    Other proteins in same PDB: d2qafa3, d2qafb3
    automated match to d2f84a1
    complexed with so4, u5p

Details for d2qafa2

PDB Entry: 2qaf (more details), 1.95 Å

PDB Description: crystal structure of plasmodium falciparum orotidine 5'-phosphate decarboxylase covalently modified by 6-iodo-ump
PDB Compounds: (A:) Orotidine 5' monophosphate decarboxylase

SCOPe Domain Sequences for d2qafa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qafa2 c.1.2.3 (A:1-322) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
ypqkaaqmyydqinailkqnme

SCOPe Domain Coordinates for d2qafa2:

Click to download the PDB-style file with coordinates for d2qafa2.
(The format of our PDB-style files is described here.)

Timeline for d2qafa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qafa3