Lineage for d1vrea_ (1vre A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1075106Protein Glycera globin [46467] (1 species)
  7. 1075107Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries)
  8. 1075115Domain d1vrea_: 1vre A: [15017]
    complexed with cmo, hem

Details for d1vrea_

PDB Entry: 1vre (more details)

PDB Description: solution structure of component iv glycera dibranchiata monomeric hemoglobin-co
PDB Compounds: (A:) protein (globin, monomeric component m-IV)

SCOPe Domain Sequences for d1vrea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrea_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}
glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
kmnaaakdawaaayadisgalisglqs

SCOPe Domain Coordinates for d1vrea_:

Click to download the PDB-style file with coordinates for d1vrea_.
(The format of our PDB-style files is described here.)

Timeline for d1vrea_: