Lineage for d1vrfa_ (1vrf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686113Protein Glycera globin [46467] (1 species)
  7. 2686114Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries)
  8. 2686121Domain d1vrfa_: 1vrf A: [15016]
    complexed with cmo, hem

Details for d1vrfa_

PDB Entry: 1vrf (more details)

PDB Description: solution structure of component iv glycera dibranchiata monomeric hemoglobin-co
PDB Compounds: (A:) protein (globin, monomeric component m-IV)

SCOPe Domain Sequences for d1vrfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrfa_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}
glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
kmnaaakdawaaayadisgalisglqs

SCOPe Domain Coordinates for d1vrfa_:

Click to download the PDB-style file with coordinates for d1vrfa_.
(The format of our PDB-style files is described here.)

Timeline for d1vrfa_: