SCOPe 2.01: Domain d2q9qa1: 2q9q A:62-173

Lineage for d2q9qa1 (2q9q A:62-173)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
   5 helices, staggered bundle;

4. Superfamily a.278.1: GINS helical bundle-like [158573] (4 families)
   common to all subunits of the GINS complex

5. Family a.278.1.2: PSF2 C-terminal domain-like [158577] (1 protein)
   C-terminal part of PF04128

6. Protein DNA replication complex GINS protein PSF2 [158578] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158579] (3 PDB entries)
   Uniprot Q9Y248 62-173

8. Domain d2q9qa1: 2q9q A:62-173 [150156]
   Other proteins in same PDB: d2q9qa2, d2q9qb1, d2q9qb2, d2q9qd1, d2q9qd2, d2q9qe2, d2q9qf1, d2q9qf2, d2q9qh1, d2q9qh2
   automatically matched to 2EHO C:62-173

Details for d2q9qa1

PDB Entry: 2q9q, 2.36 Å

PDB Description: The crystal structure of full length human GINS complex

PDB Compounds: (A:) DNA replication complex GINS protein PSF2

SCOPe Domain Sequences for d2q9qa1:

Sequence; same for both SEQRES and ATOM records:

>d2q9qa1 a.278.1.2 (A:62-173) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]}
ppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkdmw
dtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtn

Timeline for d2q9qa1:

• d2q9qa1 first appeared in SCOP 1.75
  
• d2q9qa1 appears in SCOPe 2.02
  
• d2q9qa1 appears in the current release, SCOPe 2.08