Class a: All alpha proteins [46456] (284 folds) |
Fold a.278: GINS helical bundle-like [158572] (1 superfamily) 5 helices, staggered bundle; |
Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) common to all subunits of the GINS complex |
Family a.278.1.2: PSF2 C-terminal domain-like [158577] (1 protein) C-terminal part of PF04128 |
Protein DNA replication complex GINS protein PSF2 [158578] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158579] (3 PDB entries) Uniprot Q9Y248 62-173 |
Domain d2q9qa1: 2q9q A:62-173 [150156] Other proteins in same PDB: d2q9qa2, d2q9qb1, d2q9qb2, d2q9qd1, d2q9qd2, d2q9qe2, d2q9qf1, d2q9qf2, d2q9qh1, d2q9qh2 automatically matched to 2EHO C:62-173 |
PDB Entry: 2q9q (more details), 2.36 Å
SCOPe Domain Sequences for d2q9qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q9qa1 a.278.1.2 (A:62-173) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]} ppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkdmw dtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtn
Timeline for d2q9qa1: