SCOPe 2.08: Domain d2q86d2: 2q86 D:112-235

Lineage for d2q86d2 (2q86 D:112-235)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (7 species)
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
Domain d2q86d2: 2q86 D:112-235 [150123]
Other proteins in same PDB: d2q86a1, d2q86a2, d2q86b1, d2q86c1, d2q86c2, d2q86d1
automated match to d1tcrb2
complexed with nag

Details for d2q86d2

PDB Entry: 2q86 (more details), 1.85 Å

PDB Description: structure of the mouse invariant nkt cell receptor valpha14

PDB Compounds: (D:) Vbeta8.2

SCOPe Domain Sequences for d2q86d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q86d2 b.1.1.2 (D:112-235) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

SCOPe Domain Coordinates for d2q86d2:

Click to download the PDB-style file with coordinates for d2q86d2.
(The format of our PDB-style files is described here.)

Timeline for d2q86d2: