Lineage for d1tcrb2 (1tcr B:118-247)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749812Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 2749822Domain d1tcrb2: 1tcr B:118-247 [21564]
    Other proteins in same PDB: d1tcra1, d1tcrb1
    complexed with nag, so4

Details for d1tcrb2

PDB Entry: 1tcr (more details), 2.5 Å

PDB Description: murine t-cell antigen receptor 2c clone
PDB Compounds: (B:) alpha, beta T-cell receptor (vb8.2db2jb2.4cb2;va3ja58ca)

SCOPe Domain Sequences for d1tcrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcrb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc

SCOPe Domain Coordinates for d1tcrb2:

Click to download the PDB-style file with coordinates for d1tcrb2.
(The format of our PDB-style files is described here.)

Timeline for d1tcrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tcrb1