Lineage for d1tcrb2 (1tcr B:118-247)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein T-cell antigen receptor [49125] (7 species) 
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries) 
Domain d1tcrb2: 1tcr B:118-247 [21564]
Other proteins in same PDB: d1tcra1, d1tcrb1
complexed with nag, so4
Details for d1tcrb2
PDB Entry: 1tcr (more details), 2.5 Å
PDB Description: murine t-cell antigen receptor 2c clone
PDB Compounds: (B:) alpha, beta T-cell receptor (vb8.2db2jb2.4cb2;va3ja58ca)SCOPe Domain Sequences for d1tcrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcrb2 b.1.1.2 (B:118-247) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgradc
SCOPe Domain Coordinates for d1tcrb2:
Click to download the PDB-style file with coordinates for d1tcrb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tcrb2:
- d1tcrb2 first appeared (with stable ids) in SCOP 1.55
- d1tcrb2 appears in SCOPe 2.07
View in 3D
