SCOPe 2.08: Domain d2q86a2: 2q86 A:111-191

Lineage for d2q86a2 (2q86 A:111-191)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2q86a2: 2q86 A:111-191 [198287]
   Other proteins in same PDB: d2q86b2, d2q86d2
   automated match to d1tcra2
   complexed with nag

Details for d2q86a2

PDB Entry: 2q86, 1.85 Å

PDB Description: structure of the mouse invariant nkt cell receptor valpha14

PDB Compounds: (A:) Valpha14 TCR

SCOPe Domain Sequences for d2q86a2:

Sequence, based on SEQRES records:

>d2q86a2 b.1.1.0 (A:111-191) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksng
aiawsnqtsftcqdifketna

Sequence, based on observed residues (ATOM records):

>d2q86a2 b.1.1.0 (A:111-191) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmksksngaia
wsnqtsftcqdifketna

Timeline for d2q86a2:

• d2q86a2 first appeared in SCOPe 2.03
  
• d2q86a2 appears in SCOPe 2.07