![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d2q86a2: 2q86 A:111-191 [198287] Other proteins in same PDB: d2q86b2, d2q86d2 automated match to d1tcra2 complexed with nag |
PDB Entry: 2q86 (more details), 1.85 Å
SCOPe Domain Sequences for d2q86a2:
Sequence, based on SEQRES records: (download)
>d2q86a2 b.1.1.0 (A:111-191) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmkamdsksng aiawsnqtsftcqdifketna
>d2q86a2 b.1.1.0 (A:111-191) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdkcvldmksksngaia wsnqtsftcqdifketna
Timeline for d2q86a2: