Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H3 [47122] (5 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [158386] (1 PDB entry) |
Domain d2pyoe_: 2pyo E: [149951] Other proteins in same PDB: d2pyob1, d2pyof1 automated match to d1kx5a_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 2pyo (more details), 2.43 Å
SCOPe Domain Sequences for d2pyoe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pyoe_ a.22.1.1 (E:) Histone H3 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas eaylvglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d2pyoe_: