Lineage for d2pxzx2 (2pxz X:9-227)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920701Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2920766Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species)
  7. 2920770Species Escherichia coli [TaxId:562] [68926] (10 PDB entries)
  8. 2920776Domain d2pxzx2: 2pxz X:9-227 [149927]
    Other proteins in same PDB: d2pxzx1
    automated match to d1os1a2
    complexed with atp, co2, mg, mn, oaa

Details for d2pxzx2

PDB Entry: 2pxz (more details), 2.23 Å

PDB Description: E. coli phosphoenolpyruvate carboxykinase (PEPCK) complexed with ATP, Mg2+, Mn2+, carbon dioxide and oxaloacetate
PDB Compounds: (X:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d2pxzx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pxzx2 c.109.1.1 (X:9-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
pqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrspk
dkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcgan
pdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqglnse
nfvafnltermqliggtwyggemkkgmfsmmnyllplkg

SCOPe Domain Coordinates for d2pxzx2:

Click to download the PDB-style file with coordinates for d2pxzx2.
(The format of our PDB-style files is described here.)

Timeline for d2pxzx2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pxzx1