SCOP 1.75: Domain d2pxzx2: 2pxz X:9-227

Lineage for d2pxzx2 (2pxz X:9-227)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family)

5. Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)

6. Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species)

7. Species Escherichia coli [TaxId:562] [68926] (10 PDB entries)

8. Domain d2pxzx2: 2pxz X:9-227 [149927]
   Other proteins in same PDB: d2pxzx1
   automatically matched to d1ayla2
   complexed with atp, co2, mg, mn, oaa

Details for d2pxzx2

PDB Entry: 2pxz, 2.23 Å

PDB Description: E. coli phosphoenolpyruvate carboxykinase (PEPCK) complexed with ATP, Mg2+, Mn2+, carbon dioxide and oxaloacetate

PDB Compounds: (X:) phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d2pxzx2:

Sequence; same for both SEQRES and ATOM records:

>d2pxzx2 c.109.1.1 (X:9-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
pqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrspk
dkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcgan
pdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqglnse
nfvafnltermqliggtwyggemkkgmfsmmnyllplkg

Timeline for d2pxzx2:

• d2pxzx2 is new in SCOP 1.75
  
• d2pxzx2 appears in SCOPe 2.01
  
• d2pxzx2 appears in the current release, SCOPe 2.08