Lineage for d2pxzx1 (2pxz X:228-540)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143073Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 protein domains)
  6. 2143124Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68921] (4 species)
  7. 2143128Species Escherichia coli [TaxId:562] [53798] (10 PDB entries)
  8. 2143138Domain d2pxzx1: 2pxz X:228-540 [149926]
    Other proteins in same PDB: d2pxzx2
    automated match to d1os1a1
    complexed with atp, co2, mg, mn, oaa

Details for d2pxzx1

PDB Entry: 2pxz (more details), 2.23 Å

PDB Description: E. coli phosphoenolpyruvate carboxykinase (PEPCK) complexed with ATP, Mg2+, Mn2+, carbon dioxide and oxaloacetate
PDB Compounds: (X:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d2pxzx1:

Sequence, based on SEQRES records: (download)

>d2pxzx1 c.91.1.1 (X:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsa
cfgaaflslhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsl
dnaetftlpmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdt
pagaalvaagpkl

Sequence, based on observed residues (ATOM records): (download)

>d2pxzx1 c.91.1.1 (X:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklageptptfsacfgaaf
lslhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetf
tlpmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaal
vaagpkl

SCOPe Domain Coordinates for d2pxzx1:

Click to download the PDB-style file with coordinates for d2pxzx1.
(The format of our PDB-style files is described here.)

Timeline for d2pxzx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pxzx2