Lineage for d2pqna_ (2pqn A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096244Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1096245Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 1096276Protein Mitochondria fission protein Fis1 [101417] (2 species)
  7. 1096277Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140836] (3 PDB entries)
    Uniprot P40515 1-138
  8. 1096280Domain d2pqna_: 2pqn A: [149792]
    automated match to d1y8ma1

Details for d2pqna_

PDB Entry: 2pqn (more details), 2.15 Å

PDB Description: crystal structure of yeast fis1 complexed with a fragment of yeast mdv1
PDB Compounds: (A:) Mitochondria fission 1 protein

SCOPe Domain Sequences for d2pqna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pqna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vdfwptlkdayeplypqqleilrqqvvseggptatiqsrfnyawglikstdvnderlgvk
iltdiykeaesrrreclyyltigcyklgeysmakryvdtlfehernnkqvgalksmvedk
iqketl

SCOPe Domain Coordinates for d2pqna_:

Click to download the PDB-style file with coordinates for d2pqna_.
(The format of our PDB-style files is described here.)

Timeline for d2pqna_: