Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (9 families) |
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
Protein Mitochondria fission protein Fis1 [101417] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140836] (3 PDB entries) Uniprot P40515 1-138 |
Domain d2pqna_: 2pqn A: [149792] automated match to d1y8ma1 |
PDB Entry: 2pqn (more details), 2.15 Å
SCOPe Domain Sequences for d2pqna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pqna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vdfwptlkdayeplypqqleilrqqvvseggptatiqsrfnyawglikstdvnderlgvk iltdiykeaesrrreclyyltigcyklgeysmakryvdtlfehernnkqvgalksmvedk iqketl
Timeline for d2pqna_: