SCOPe 2.02: Domain d2pqac_: 2pqa C:

Lineage for d2pqac_ (2pqa C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
   barrel, closed; n=5, S=10

6. Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50270] (5 PDB entries)

8. Domain d2pqac_: 2pqa C: [149790]
   Other proteins in same PDB: d2pqab1, d2pqad1
   automated match to d1l1ob_

Details for d2pqac_

PDB Entry: 2pqa, 2.5 Å

PDB Description: Crystal Structure of Full-length Human RPA 14/32 Heterodimer

PDB Compounds: (C:) Replication protein A 32 kDa subunit

SCOPe Domain Sequences for d2pqac_:

Sequence; same for both SEQRES and ATOM records:

>d2pqac_ b.40.4.3 (C:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevi
nahmvls

Timeline for d2pqac_:

• d2pqac_ first appeared in SCOP 1.75, called d2pqac1
  
• d2pqac_ appears in SCOPe 2.01
  
• d2pqac_ appears in SCOPe 2.03
  
• d2pqac_ appears in the current release, SCOPe 2.08